PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00808.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 365aa    MW: 42611.5 Da    PI: 6.364
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00808.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.22.4e-51161441128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPt+eel+++yL+kkv+++k++l +vi+evd++k+ePwd+++  ++ +  +++wyfFs++dkky+tg+r+nrat sg+W
  Rsa1.0_00808.1_g00003.1  16 VPPGFRFHPTEEELLHYYLRKKVHSQKIDL-DVIREVDLNKLEPWDIQEecRIGStPQNDWYFFSHKDKKYPTGTRTNRATVSGFW 100
                              69****************************.9***************963433332456*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              katg+dk ++s   + +gl+ktLvfy+grap+g+k+dW+mheyrl
  Rsa1.0_00808.1_g00003.1 101 KATGRDKIIYS-CVRRIGLRKTLVFYQGRAPHGQKSDWIMHEYRL 144
                              **********9.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-5612177IPR003441NAC domain
PROSITE profilePS5100555.2116177IPR003441NAC domain
PfamPF023654.8E-2717144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MAENKVNLSI NGQSKVPPGF RFHPTEEELL HYYLRKKVHS QKIDLDVIRE VDLNKLEPWD  60
IQEECRIGST PQNDWYFFSH KDKKYPTGTR TNRATVSGFW KATGRDKIIY SCVRRIGLRK  120
TLVFYQGRAP HGQKSDWIMH EYRLDETPTI NEYSDVVSED PMSYYEEGWV VCRVFRKKNY  180
RKIDDSPRTT LSSSPDATEE KRRSTTSHDN QNGNVLDHVL LYMNHSCPNI CMPEHQTTIP  240
TQRNQDDILF MQVRSLETPK SEDLVDQSLK IPHQVDHSSL VQEKKTGGPV CSNWASLDRL  300
VAWQLNNGHH KCDRTSFDEE EEYGDTMMQR WDLHWSNDDH VDFWSSFTES SSSPSSLDPL  360
LHLSV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-481617915170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9747550.0KF974755.1 Brassica napus NAC transcription factor 12-1 (NAC12-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013722616.10.0PREDICTED: NAC domain-containing protein 12-like
SwissprotQ9LPI70.0NAC12_ARATH; NAC domain-containing protein 12
TrEMBLA0A078ENZ60.0A0A078ENZ6_BRANA; BnaC05g24890D protein
STRINGBra023288.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77828124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32770.10.0NAC domain containing protein 12